PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000298689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 319aa    MW: 36224.7 Da    PI: 7.5659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000298689genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.5e-171256247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     g+W ++Ed  l+++v+q+G+ +W++I+  ++ gR++k+c++rw + 
    MDP0000298689 12 GSWNPQEDATLIKLVAQHGPSNWSLISTGIP-GRSGKSCRLRWCNQ 56
                     89*****************************.***********985 PP

2Myb_DNA-binding56.94.7e-1864107247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++++Ed ++++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000298689  64 KPFSPQEDSIIIQAHALHGNK-WATIARLLP-GRTDNAIKNHWNST 107
                      689******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.421661IPR017930Myb domain
SuperFamilySSF466891.01E-289104IPR009057Homeodomain-like
SMARTSM007173.5E-121059IPR001005SANT/Myb domain
PfamPF002491.2E-161156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-241264IPR009057Homeodomain-like
CDDcd001679.28E-131355No hitNo description
PROSITE profilePS5129419.67662112IPR017930Myb domain
SMARTSM007171.3E-1562110IPR001005SANT/Myb domain
PfamPF002491.6E-1564107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2265110IPR009057Homeodomain-like
CDDcd001672.03E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGAMSSEDRV TGSWNPQEDA TLIKLVAQHG PSNWSLISTG IPGRSGKSCR LRWCNQLCPT  60
VQHKPFSPQE DSIIIQAHAL HGNKWATIAR LLPGRTDNAI KNHWNSTLRR WRRQLAKLSS  120
ESSCSDSAAA HGEEPDLKRQ CLRASPEHES LKADAGGEGV IVKTSLTLSP PGENAENDVA  180
VKSEEEEHDR EAVDNNDDGE KCAVEMDETC LLTIMQRMIA QEVRNYIYGL RPDGGPTFGL  240
HSAHQNENDA QQNMETEAKR RRLMIGDSER ANYLDLCLIF RRFLFNLLMR FFFHCNHRRK  300
KMHRKRINQR TQSEDEQKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-35101103103MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-351011057157MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-351011057157MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-35101103103C-Myb DNA-Binding Domain
1msf_C1e-35101103103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258262KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700271e-115KC770027.1 Pyrus pyrifolia microsatellite TXY079 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369404.10.0PREDICTED: transcription factor MYB23-like
TrEMBLM5XTD91e-119M5XTD9_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01360.t014e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-49myb domain protein 73